PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009593145.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 358aa    MW: 40501.3 Da    PI: 6.8599
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009593145.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.49.4e-201562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lvd+++++G ++W++ ++  g++R++k+c++rw +yl
   XP_009593145.1 15 KGPWTPEEDQKLVDYIHKYGHENWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding56.94.9e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++l+v+++ +lG++ W++Ia +++ gRt++++k++w+++l
   XP_009593145.1  68 RGKFSEDEEKLIVKLHSLLGNK-WSAIATRLP-GRTDNEIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1651062IPR017930Myb domain
SuperFamilySSF466892.22E-3112109IPR009057Homeodomain-like
SMARTSM007171.6E-161464IPR001005SANT/Myb domain
PfamPF002493.5E-181562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-251669IPR009057Homeodomain-like
CDDcd001673.22E-131762No hitNo description
PROSITE profilePS5129427.50163117IPR017930Myb domain
SMARTSM007176.1E-1767115IPR001005SANT/Myb domain
PfamPF002496.1E-1768113IPR001005SANT/Myb domain
CDDcd001671.14E-1270113No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MRRSAEFDDM SGLKKGPWTP EEDQKLVDYI HKYGHENWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEDEEKLIV KLHSLLGNKW SAIATRLPGR TDNEIKNYWN THLRKKLLQM  120
GIDPVTHRPR TDHINLFNAL IGNLPPQLLA AFTSSFINTN TSSINPQFDM NNTLTNSLFS  180
DTTQLIHQIQ LLQNSSLLVN SLIRNATATT SPLNIEALNQ ILGSHNQLQE YNSTFQQFLS  240
NSSDSLIDFG LKSSNVNAEF THANNFSGKL DYQEINDTKL GGDQLILSGT CSTSSSVIGN  300
DQMKNISKMP NENTSDIYPK QELIMQPSSA STSTFEAWDQ IMGNEEASDS YWRDISNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009593145.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A067E7P23e-94A0A067E7P2_CITSI; Uncharacterized protein
TrEMBLV4VTJ45e-94V4VTJ4_9R
STRINGVIT_16s0039g01710.t015e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-80myb domain protein 9